PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G2588
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 262aa    MW: 30526.6 Da    PI: 9.5402
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G2588genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.85.7e-144389147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-.HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRt.lkqcksrwqky 47
                     rg W + Ede+l + v+++G+++W++Ia++++ gR+ +k+c++rw++ 
      Gh_D12G2588 43 RGHWRPAEDEKLRESVERYGPHNWNAIAQKLQ-GRSaGKSCRLRWFNQ 89
                     899*****************************.999459******996 PP

2Myb_DNA-binding60.34e-1996139146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ 
      Gh_D12G2588  96 RSPFTEEEEERLLSAHRIHGNR-WAVIARLFP-GRTDNAVKNHWHV 139
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.5943890IPR017930Myb domain
SMARTSM007171.9E-104292IPR001005SANT/Myb domain
PfamPF002491.4E-134389IPR001005SANT/Myb domain
SuperFamilySSF466893.07E-2743137IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-244497IPR009057Homeodomain-like
CDDcd001672.44E-114688No hitNo description
PROSITE profilePS5129426.2791145IPR017930Myb domain
SMARTSM007172.8E-1695143IPR001005SANT/Myb domain
PfamPF002493.7E-1696138IPR001005SANT/Myb domain
CDDcd001671.64E-1298138No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2198144IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MRSTCCLVSP PSTIFILLSA LLFPIFLGVE FFIELKDKQM CSRGHWRPAE DEKLRESVER  60
YGPHNWNAIA QKLQGRSAGK SCRLRWFNQL DPRINRSPFT EEEEERLLSA HRIHGNRWAV  120
IARLFPGRTD NAVKNHWHVI MARRCRQRSS LYAKTSHTNP SKPLHHSQMG AGHGFLPLLH  180
KYKQGFPHNT WSPLNPNHCV TTTQDKKEAI EFYDFLQVNT DSNNKSEVTE NSRRDDEEVN  240
QQEAMPLTEH HTKARPSFFN FL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31431457108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5903083e-67JX590308.1 Gossypium hirsutum clone NBRI_GE25197 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440359.11e-164PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0D2RPJ80.0A0A0D2RPJ8_G
STRINGPOPTR_0012s03650.19e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-77myb domain protein 52